missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SEZ6L2/BSRP-A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 369.00 - € 559.00
Specifications
| Antigen | SEZ6L2/BSRP-A |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18112228
|
Novus Biologicals
NBP2-38051 |
0.1 mL |
€ 559.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18692586
|
Novus Biologicals
NBP2-38051-25ul |
25 μL |
€ 369.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SEZ6L2/BSRP-A Polyclonal specifically detects SEZ6L2/BSRP-A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| SEZ6L2/BSRP-A | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| seizure 6-like protein 2, seizure related 6 homolog (mouse)-like 2, UNQ1903/PRO4349 | |
| SEZ6L2 | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q6UXD5 | |
| 26470 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: RGLISDAQSLYVELLSETPANPLLLSLRFEAFEEDRCFAPFLAHGNVTTTDPEYRPGALATFSCLPGYALEPPGPPNAIECV | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title