missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SF3B5 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 196.00 - € 468.00
Specifications
| Antigen | SF3B5 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
SF3B5 Polyclonal antibody specifically detects SF3B5 in Human, Mouse, Rat samples. It is validated for Western BlotSpecifications
| SF3B5 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human, Mouse, Rat | |
| MGC3133, Pre-mRNA-splicing factor SF3b 10 kDa subunit, SF3b10, SF3b5, splicing factor 3B subunit 5, splicing factor 3b, subunit 5, 10kDa, Ysf3 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-86 of human SF3B5 (NP_112577.1). MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPCGPPADKPEEN | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol | |
| 83443 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title