missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SGLT1/SLC5A1 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-33492-20ul
This item is not returnable.
View return policy
Description
SGLT1/SLC5A1 Monoclonal antibody specifically detects SGLT1/SLC5A1 in Human samples. It is validated for ELISA,Western Blot
Specifications
| SGLT1/SLC5A1 | |
| Monoclonal | |
| Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL | |
| D22S675, High affinity sodium-glucose cotransporter, Na+/glucose cotransporter 1, NAGTsodium/glucose cotransporter 1, SGLT1Na(+)/glucose cotransporter 1, solute carrier family 5 (sodium/glucose cotransporter), member 1, Solute carrier family 5 member 1 | |
| A synthetic peptide corresponding to a sequence within amino acids 323-422 of human SGLT1/SLC5A1 (NP_000334.1).,, Sequence:, MPMFIMVMPGMISRILYTEKIACVVPSECEKYCGTKVGCTNIAYPTLVVELMPNGLRGLMLSVMLASLMSSLTSIFNSASTLFTMDIYAKVRKRASEKEL | |
| 20 μL | |
| Membrane Trafficking and Chaperones | |
| 6523 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction