missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SH3BP4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-86274
This item is not returnable.
View return policy
Description
SH3BP4 Polyclonal specifically detects SH3BP4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Inhibition of T-cells.
Specifications
| SH3BP4 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50, Inhibition of T-cells | |
| BOG25SH3 domain-binding protein 4, EHB10, EH-binding protein 10, SH3-domain binding protein 4, transferrin receptor trafficking protein, Transferrin receptor-trafficking protein, TTP | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Inhibition Assays | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| SH3BP4 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:EGTLIDLSEGFSETSFNDIKVPSPSALLVDNPTPFGNAKEVIAIKDYCPTNFTTLKFSKGDHLYVLDTSGGEWWYAHNT | |
| 0.1 mL | |
| Cell Cycle and Replication | |
| 23677 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction