missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SH3PXD2A Antibody, Novus Biologicals™

SH3PXD2A Antibody, Novus Biologicals™

Product Code. 18796723 Shop All Bio Techne Products
Change view
Click to view available options
Unit Size:
0.1mL
25µL
Quantity:
25 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. unitSize Quantity
18796723 0.1mL -
18440402 25µL 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18796723 Supplier Novus Biologicals Supplier No. NBP190454

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

SH3PXD2A Polyclonal specifically detects SH3PXD2A in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen SH3PXD2A
Applications Immunohistochemistry (Paraffin)
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PDPSGKELDTVPAKGRQNEGKSDSLEKIERRVQALNTVNQSKKATPPIPSKPPGGFGKTSGTPAVKMRNGVRQVAVRPQSVFVSP
Regulatory Status RUO
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.