missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SHMT1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 489.00
Specifications
| Antigen | SHMT1 |
|---|---|
| Dilution | Western Blot 0.04 - 0.4 ug/mL, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25 - 2 ug/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18493202
|
Novus Biologicals
NBP1-85437-25ul |
25 μL |
N/A
|
N/A | |||||
|
18299026
|
Novus Biologicals
NBP1-85437 |
0.1 mL |
€ 489.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SHMT1 Polyclonal specifically detects SHMT1 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| SHMT1 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human, Mouse | |
| 14 kDa protein, CSHMT, cytoplasmic serine hydroxymethyltransferase, Glycine hydroxymethyltransferase, MGC15229, MGC24556, serine hydroxymethyltransferase 1 (soluble), serine hydroxymethyltransferase, cytosolic, Serine methylase, SHMTEC 2.1.2.1 | |
| SHMT1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.04 - 0.4 ug/mL, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25 - 2 ug/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| metabolism | |
| PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
| 6470 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:MTMPVNGAHKDADLWSSHDKMLAQPLKDSDVEVYNIIKKESNRQRVGLELIASENFASRAVLEALGSCL | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title