missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Shugoshin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 624.00
Specifications
| Antigen | Shugoshin |
|---|---|
| Dilution | Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18229011
|
Novus Biologicals
NBP2-55825 |
100 μL |
€ 624.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18641777
|
Novus Biologicals
NBP2-55825-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Shugoshin Polyclonal specifically detects Shugoshin in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Shugoshin | |
| Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| FLJ14230, hSgo1, NY-BR-85, Serologically defined breast cancer antigen NY-BR-85, SGO, SGO1, shugoshin 1AB protein, shugoshin 1CD protein, shugoshin 1EF protein, shugoshin 1GH protein, shugoshin 1KL protein, shugoshin-like 1, shugoshin-like 1 (S. pombe) | |
| SGO1 | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| Cancer | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 151648 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TASVNYKEPTLASKLRRGDPFTDLCFLNSPIFKQKKDLRRSKKRALEVSPAKEAIFILYYVREFVSRFPDCRKCKLETH | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title