missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Siglec-6/CD327 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 386.00 - € 529.00
Specifications
| Antigen | Siglec-6/CD327 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18467140
|
Novus Biologicals
NBP1-85757-25ul |
25 μL |
€ 386.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18261826
|
Novus Biologicals
NBP1-85757 |
0.1 mL |
€ 529.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Siglec-6/CD327 Polyclonal specifically detects Siglec-6/CD327 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Siglec-6/CD327 | |
| Polyclonal | |
| Rabbit | |
| Immunology | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 946 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:RVKTRRKKAAQPVQNTDDVNPVMVSGSRGHQHQFQTGIVSDHPAEAGPISEDEQELHYAVLHFHKVQPQEPKVTDTEYSEIKIHK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| CD327 antigen, CD33 antigen-like 1, CD33L1OBBP1CD327, CD33L2, CD33LCDW327, CDw327, OB-BP1, Obesity-binding protein 1, sialic acid binding Ig-like lectin 6, sialic acid-binding Ig-like lectin 6, Siglec-6 | |
| SIGLEC6 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title