Learn More
Invitrogen™ SKA2 Polyclonal Antibody

Rabbit Polyclonal Antibody
Brand: Invitrogen™ PA5114386
Description
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human A431 whole cell, human U2OS whole cell, human PC-3 whole cell, human HEK293 whole cell, human HL-60 whole cell, human K562 whole cell, human Caco-2 whole cell, human Hela whole cell. Flow: 293T cell, U20S cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Upon entry into mitosis, the cell's microtubule (MT) network forms the mitotic spindle, allowing the segregation of paired chromosomes. Proteinaceous structures on centromeric chromatin termed kinetochores (KT) are essential for the proper attachment of the chromosomes to the spindle MTs. A recently discovered spindle and kinetochore complex, comprised of proteins SKA1, SKA2, and SKA3, has been found to be required for stable KT-MT interactions and timely anaphase onset. Depletion of either SKA1 or SKA2 by siRNA results in the loss of both proteins from the KT, but does not impact overall KT structure. Cells depleted of the SKA complex undergo a prolonged checkpoint-dependent delay in a metaphase-like state, indicating the importance of the SKA complex in the maintenance of the metaphase plate and spindle checkpoint silencing. SKA2 has also been shown to interact with glucocorticoid receptors and to be involved in glucocorticoid signaling and cell proliferation.
Specifications
| SKA2 | |
| Polyclonal | |
| Unconjugated | |
| SKA2 | |
| 1110001A07Rik; C78640; FAM33A; family with sequence similarity 33, member A; Protein FAM33A; RGD1307084; Ska2; spindle and kinetochore associated complex subunit 2; spindle and kinetochore-associated protein 2; spindle and KT (kinetochore) associated 2 | |
| Rabbit | |
| Affinity chromatography | |
| RUO | |
| 348235 | |
| -20°C | |
| Lyophilized |
| Flow Cytometry, Western Blot | |
| 500 μg/mL | |
| PBS with 4mg trehalose and 0.05mg sodium azide | |
| Q8WVK7 | |
| SKA2 | |
| A synthetic peptide corresponding to a sequence of human SKA2 (EAEVDKLELMFQKAESDLDYIQYRLEYEIK). | |
| 100 μg | |
| Primary | |
| Human | |
| Antibody | |
| IgG |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.