missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ skp (Escherichia coli) Recombinant Protein
Description
Sequence: MGSSHHHHHHSSGLVPRGSHMADKIAIVNMGSLFQQVAQKTGVSNTLENEFKGRASELQRMETDLQAKMKKLQSMKAGSDRTKLEKDVMAQRQTFAQKAQAFEQDRARRSNEERGKLVTRIQTAVKSVANSQDIDLVVDANAVAYNSSDVKDITADVLKQVK
Specifications
Specifications
| Accession Number | NP_414720 |
| Concentration | 1 mg/mL |
| For Use With (Application) | SDS-PAGE |
| Formulation | Liquid |
| Gene ID (Entrez) | 944861 |
| Molecular Weight (g/mol) | 12.9kDa |
| Name | skp (Escherichia coli) Recombinant protein |
| Preparation Method | Escherichia coli expression system |
| Purification Method | Conventional Chromatography |
| Quality Control Testing | 15% SDS-PAGE Stained with Coomassie Blue |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?