missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 16151710

Abnova™ skp (Escherichia coli) Recombinant Protein

Product Code. 16151710
Change view
Click to view available options
:
100μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code.
16151710 100μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 16151710 Supplier Abnova™ Supplier No. P4982.100ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Used for SDS-PAGE

Sequence: MGSSHHHHHHSSGLVPRGSHMADKIAIVNMGSLFQQVAQKTGVSNTLENEFKGRASELQRMETDLQAKMKKLQSMKAGSDRTKLEKDVMAQRQTFAQKAQAFEQDRARRSNEERGKLVTRIQTAVKSVANSQDIDLVVDANAVAYNSSDVKDITADVLKQVK

Specifications

Accession Number NP_414720
Concentration 1 mg/mL
For Use With (Application) SDS-PAGE
Formulation Liquid
Gene ID (Entrez) 944861
Molecular Weight (g/mol) 12.9kDa
Name skp (Escherichia coli) Recombinant protein
Preparation Method Escherichia coli expression system
Purification Method Conventional Chromatography
Quality Control Testing 15% SDS-PAGE Stained with Coomassie Blue
Quantity 100 ug
Immunogen MGSSHHHHHHSSGLVPRGSHMADKIAIVNMGSLFQQVAQKTGVSNTLENEFKGRASELQRMETDLQAKMKKLQSMKAGSDRTKLEKDVMAQRQTFAQKAQAFEQDRARRSNEERGKLVTRIQTAVKSVANSQDIDLVVDANAVAYNSSDVKDITADVLKQVK
Storage Requirements Store at -20°C. For long term storage store at -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias ECK0177/JW0173/hlpA/ompH
Common Name skp
Gene Symbol skp
Species E. coli
Protein Tag His
Expression System Escherichia coli expression system
Form Liquid
Purity or Quality Grade >95% by SDS-PAGE
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.