missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC10A1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-60109
This item is not returnable.
View return policy
Description
SLC10A1 Polyclonal specifically detects SLC10A1 in Human samples. It is validated for Western Blot, Flow Cytometry, Block/Neutralize.
Specifications
| SLC10A1 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| Cell growth-inhibiting gene 29 protein, Na(+)/bile acid cotransporter, Na(+)/taurocholate transport protein, Na/taurocholate cotransporting polypeptide, NTCP, NTCP1, NTCPgrowth-inhibiting protein 29, sodium/bile acid cotransporter, sodium/taurocholate cotransporter, Sodium/taurocholate cotransporting polypeptide, solute carrier family 10 (sodium/bile acid cotransporter family), member 1, Solute carrier family 10 member 1 | |
| Rabbit | |
| 38 kDa | |
| 100 μL | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot, Flow Cytometry, Blocking Assay | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml, Flow Cytometry, Blocking Assay | |
| Q14973 | |
| SLC10A1 | |
| Synthetic peptides corresponding to SLC10A1(solute carrier family 10 (sodium/bile acid cotransporter family), member 1) The peptide sequence was selected from the middle region of SLC10A1 (NP_003040). Peptide sequence VFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPY The peptide sequence for this immunogen was taken from within the described region. | |
| Affinity purified | |
| RUO | |
| 6554 | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction