missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC22A12 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-82500
This item is not returnable.
View return policy
Description
SLC22A12 Polyclonal specifically detects SLC22A12 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| SLC22A12 | |
| Polyclonal | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| SLC22A12 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:ESARWLLTTGRLDWGLQELWRVAAINGKGAVQDTLTPEVLLSAMREELSMGQPPASLGTLLRMPGLRFRTCI | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| 0.2mg/mL | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| OATL4, Organic anion transporter 4-like protein, Renal-specific transporter, RSTmember 12, solute carrier family 22 (organic anion/urate transporter), member 12, URAT1, URAT1Urate anion exchanger 1, urate transporter 1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 116085 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction