missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC22A8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-92396
This item is not returnable.
View return policy
Description
SLC22A8 Polyclonal specifically detects SLC22A8 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| This antibody was developed against Recombinant Protein corresponding to amino acids:KKEEGERLSLEELKLNLQKEISLAKAKYTASDLFRIPMLR | |
| 0.1 mL | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction