missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC24A2 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 196.00 - € 462.00
Specifications
| Antigen | SLC24A2 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
SLC24A2 Polyclonal antibody specifically detects SLC24A2 in Human, Mouse samples. It is validated for Western BlotSpecifications
| SLC24A2 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Growth and Development, Neuronal Cell Markers | |
| PBS with 50% glycerol, pH7.3. | |
| 25769 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| retinal cone Na-Ca+K exchanger, solute carrier family 24 (sodium/potassium/calcium exchanger), member 2 | |
| A synthetic peptide corresponding to a sequence within amino acids 300-400 of human SLC24A2 (NP_001180217.1). VKVTAPEAQAKPSAARDKDEPTLPAKPRLQRGGSSASLHNSLMRNSIFQLMIHTLDPLAEGRFREKASILHKIAKKKCHVDENERQNGAANHVEKIELPNS | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title