missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC25A26 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93236-0.1ml
This item is not returnable.
View return policy
Description
SLC25A26 Polyclonal antibody specifically detects SLC25A26 in Mouse samples. It is validated for Western Blot
Specifications
| SLC25A26 | |
| Polyclonal | |
| Western Blot 1:200-1:2000 | |
| FLJ77340, member 26, mitochondrial S-adenosylmethionine transporter, S-adenosylmethionine mitochondrial carrier protein, SAMC, solute carrier family 25, member 26 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 105-185 of human SLC25A26 (NP_775742.4). IRVPSEVVKQRAQVSASTRTFQIFSNILYEEGIQGLYRGYKSTVLREIPFSLVQFPLWESLKALWSWRQDHVVDSWQSAVC | |
| 0.1 mL | |
| Primary | |
| Mouse | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 115286 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction