missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC25A35 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-13324
Denne vare kan ikke returneres.
Se returpolicy
Beskrivelse
SLC25A35 Polyclonal specifically detects SLC25A35 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Tekniske data
| SLC25A35 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin | |
| FLJ40217, MGC120446, MGC120448, solute carrier family 25 member 35, solute carrier family 25, member 35 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 399512 | |
| Human | |
| IgG |
| Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| SLC25A35 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: IYMVKTHLQAQAASEIAVGHQYKHQGMFQALTEIGQKHGLVGLWRGALGGLPRVIVGSSTQLCTFSSTKDLLSQ | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel
For Research Use Only
Ser du en mulighed for forbedring?Del en indholdskorrektion