missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC25A35 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-13324-25ul
This item is not returnable.
View return policy
Description
SLC25A35 Polyclonal specifically detects SLC25A35 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| SLC25A35 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin | |
| FLJ40217, MGC120446, MGC120448, solute carrier family 25 member 35, solute carrier family 25, member 35 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 399512 | |
| Human | |
| IgG |
| Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| SLC25A35 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: IYMVKTHLQAQAASEIAVGHQYKHQGMFQALTEIGQKHGLVGLWRGALGGLPRVIVGSSTQLCTFSSTKDLLSQ | |
| 25ul | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur