missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC25A43 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94209-0.1ml
This item is not returnable.
View return policy
Description
SLC25A43 Polyclonal antibody specifically detects SLC25A43 in Human samples. It is validated for Western Blot
Specifications
| SLC25A43 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000 | |
| solute carrier family 25 member 43, solute carrier family 25, member 43 | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human slc25a43 (NP_660348.2). MATWRRDGRLTGGQRLLCAGLAGTLSLSLTAPLELATVLAQVGVVRGHARGPWATGHRVWRAEGLRALWKGNAVACLRLFPCSAVQLAAYRKFVVLFTDD | |
| 0.1 mL | |
| Endocrinology, Signal Transduction | |
| 203427 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction