missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SLC25A43 Antibody - Azide and BSA Free, R&D Systems™

SLC25A43 Antibody - Azide and BSA Free, R&D Systems™

Product Code. 18604952 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.02 mL
0.1 mL
Unit Size:
0.02mL
0.10mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity Unit Size
18604952 0.1 mL 0.10mL
18606302 0.02 mL 0.02mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18604952 Supplier Novus Biologicals Supplier No. NBP2942090.1ml
 Restricted Item
Estimated Shipment: 04-12-2026
Add to basket
Add to basket

missing translation for 'validMainframeMsg'

This item is not returnable. View return policy

Description

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

SLC25A43 Polyclonal specifically detects SLC25A43 in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen SLC25A43
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:1000
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias solute carrier family 25 member 43, solute carrier family 25, member 43
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human slc25a43 (NP_660348.2). MATWRRDGRLTGGQRLLCAGLAGTLSLSLTAPLELATVLAQVGVVRGHARGPWATGHRVWRAEGLRALWKGNAVACLRLFPCSAVQLAAYRKFVVLFTDD
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Endocrinology, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 203427
Target Species Human
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Product Type Antibody
Form Purified
Isotype IgG
Product Line Novus
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.