missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC26A4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-85237
This item is not returnable.
View return policy
Beskrivning
SLC26A4 Polyclonal specifically detects SLC26A4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.
Specifikationer
| SLC26A4 | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:10-1:20, Immunohistochemistry-Frozen | |
| DFNB4, EVA, PDSTDH2B, pendrin, Sodium-independent chloride/iodide transporter, Solute carrier family 26 member 4, solute carrier family 26, member 4 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 5172 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| SLC26A4 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:FGLLTVVLRVQFPSWNGLGSIPSTDIYKSTKNYKNIEEPQGVKILRFSSPIFYGNVDGFKKCIKSTVGFDAIRVYNKRLKALRK | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel
For Research Use Only
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering