missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC28A2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 624.00
Specifications
| Antigen | SLC28A2 |
|---|---|
| Dilution | Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18414872
|
Novus Biologicals
NBP2-33451-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18128833
|
Novus Biologicals
NBP2-33451 |
0.1 mL |
€ 624.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SLC28A2 Polyclonal specifically detects SLC28A2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| SLC28A2 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CNT2SPNT, Concentrative nucleoside transporter 2, FLJ21468, HCNT2, HsT17153, MGC138252, Na(+)/nucleoside cotransporter 2, sodium/nucleoside cotransporter 2, Sodium/purine nucleoside co-transporter, Sodium-coupled nucleoside transporter 2, solute carrier family 28 (sodium-coupled nucleoside transporter), member 2, Solute carrier family 28 member 2, SPNT1CNT 2 | |
| SLC28A2 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| O43868 | |
| 9153 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: MEKASGRQSIALSTVETGTVNLGLELMEKEVEPEGSKRTDAQGHSLGDGLGPSTYQRRSRWPFSKARSFCKTHASLFKK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title