missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC39A9/ZIP9 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00
Specifications
| Antigen | SLC39A9/ZIP9 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SLC39A9/ZIP9 Polyclonal specifically detects SLC39A9/ZIP9 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| SLC39A9/ZIP9 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 55334 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VPEGVHALYEDILEGKHHQASETHNVIASDKAAEKSVVHEHEHSHDHTQLHAYI | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| FLJ11274, MGC74989, solute carrier family 39 (zinc transporter), member 9, Solute carrier family 39 member 9, zinc transporter SLC39A9, zinc transporter ZIP9, ZIP9, ZIP-9, Zrt- and Irt-like protein 9 | |
| SLC39A9 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title