missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC4A4 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94138-0.02ml
This item is not returnable.
View return policy
Description
SLC4A4 Polyclonal antibody specifically detects SLC4A4 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Specifications
| SLC4A4 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200 | |
| electrogenic sodium bicarbonate cotransporter 1, hhNMC, HNBC1, KNBC, kNBC1, Na(+)/HCO3(-) cotransporter, NBC, NBC1DKFZp781H1314, NBC2, NBCE1, pNBC, SLC4A5, Sodium bicarbonate cotransporter, sodium bicarbonate cotransporter 1 (sodium bicarbonate cotransporter, kidney;sodium bicarbonate cotransporter, pancreas), Solute carrier family 4 member 4, solute carrier family 4, sodium bicarbonate cotransporter, member 4, solute carrier family 4, sodium bicarbonate cotransporter, member 4, brain type, solute carrier family 4, sodium bicarbonate cotransporter, member 5 | |
| A synthetic peptide corresponding to a sequence within amino acids 978-1078 of human SLC4A4 (NP_001091954.1). VMILALVAVRKGMDYLFSQHDLSFLDDVIPEKDKKKKEDEKKKKKKKGSLDSDNDDSDCPYSEKVPSIKIPMDIMEQQPFLSDSKPSDRERSPTFLERHTS | |
| 0.02 mL | |
| Endocrinology, Neuroscience, Signal Transduction | |
| 8671 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction