missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC6A2/NET/Noradrenaline transporter Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-62704
This item is not returnable.
View return policy
Description
SLC6A2/NET/Noradrenaline transporter Polyclonal antibody specifically detects SLC6A2/NET/Noradrenaline transporter in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| SLC6A2/NET/Noradrenaline transporter | |
| Polyclonal | |
| Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
| NAT1neurotransmitter transporter, NET, NET1sodium-dependent noradrenaline transporter, Norepinephrine transporter, SLC6A5, solute carrier family 6 (neurotransmitter transporter, noradrenalin), member 2, Solute carrier family 6 member 2, solute carrier family 6 member 5 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: MLLARMNPQVQPENNGADTGPEQPLRARKTAELLVVKERNGVQCLLA | |
| 100 μg | |
| Cardiovascular Biology, Neuroscience | |
| 6530 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction