missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC6A4/5-HTTLPR/Serotonin transporter Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 302.00 - € 529.00
Specifications
| Antigen | SLC6A4/5-HTTLPR/Serotonin transporter |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18276214
|
Novus Biologicals
NBP2-57729 |
100 μL |
€ 529.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18604317
|
Novus Biologicals
NBP2-57729-25ul |
25 μL |
€ 302.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SLC6A4/5-HTTLPR/Serotonin transporter Polyclonal specifically detects SLC6A4/5-HTTLPR/Serotonin transporter in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| SLC6A4/5-HTTLPR/Serotonin transporter | |
| Polyclonal | |
| Rabbit | |
| Neuroscience | |
| 5HT transporter, 5-HTT, hSERT, HTT5-hydroxytryptamine transporter, Na+/Cl- dependent serotonin transporter, OCD1, SERT, sodium-dependent serotonin transporter, solute carrier family 6 (neurotransmitter transporter, serotonin), member 4,5-HTTLPR, Solute carrier family 6 member 4,5HTT | |
| SLC6A4 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 6532 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGI | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title