missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals SLP-76/LCP2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-87033
This item is not returnable.
View return policy
Description
SLP-76/LCP2 Polyclonal antibody specifically detects SLP-76/LCP2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| SLP-76/LCP2 | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| lymphocyte cytosolic protein 2, lymphocyte cytosolic protein 2 (SH2 domain containing leukocyte protein of76kDa), lymphocyte cytosolic protein 2 (SH2 domain-containing leukocyte protein of76kD), SH2 domain-containing leukocyte protein of 76 kDa, SH2 domain-containing leukocyte protein of 76kD, SLP-76, SLP-76 tyrosine phosphoprotein, SLP7676 kDa tyrosine phosphoprotein | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: GARFLNLTENDIQKFPKLRVPILSKLSQEINKNEERRSIFTRKPQVPRFPEETESHEEDNGGWSSFEEDDYESPNDDQDGE | |
| 0.1 mL | |
| Signal Transduction | |
| 3937 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction