missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SMARCA6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00 - € 624.00
Specifications
| Antigen | SMARCA6 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18627395
|
Novus Biologicals
NBP2-38986-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18125309
|
Novus Biologicals
NBP2-38986 |
0.1 mL |
€ 624.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SMARCA6 Polyclonal specifically detects SMARCA6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| SMARCA6 | |
| Polyclonal | |
| Rabbit | |
| Core ESC Like Genes, Stem Cell Markers | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| EC 3.6.1, EC 3.6.4.-, helicase, lymphoid-specific, LSHSWI/SNF2-related, matrix-associated, actin-dependent regulator of chromatin, Nbla10143, PASGFLJ10339, Proliferation-associated SNF2-like protein, SMARCA6lymphoid-specific helicase, subfamily A, member 6, SWI/SNF2-related matrix-associated actin-dependent regulator of chromatinsubfamily A member 6 | |
| HELLS | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| Q9NRZ9 | |
| 3070 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: VVYAPLSKKQEIFYTAIVNRTIANMFGSSEKETIELSPTGRPKRRTRKSINYSKIDDFPNELEKLISQIQPEVDRERAVVEVNIPV | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title