missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 15955605

Invitrogen™ SMC3 Polyclonal Antibody

Product Code. 15955605
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
15955605 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 15955605 Supplier Invitrogen™ Supplier No. PA580041

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Rat Brain Tissue, Rat Liver Tissue, Rat Testis Tissue, HELA whole cell, A549 whole cell, MCF-7 whole cell, NIH3T3 whole cell. IHC: mouse intestine tissue, rat kidney tissue, human intestinal cancer tissue.

This gene belongs to the SMC3 subfamily of SMC proteins. The encoded protein occurs in certain cell types as either an intracellular, nuclear protein or a secreted protein. The nuclear form, known as structural maintenance of chromosomes 3, is a component of the multimeric cohesin complex that holds together sister chromatids during mitosis, enabling proper chromosome segregation. Post-translational modification of the encoded protein by the addition of chondroitin sulfate chains gives rise to the secreted proteoglycan bamacan, an abundant basement membrane protein.
TRUSTED_SUSTAINABILITY

Specifications

Antigen SMC3
Applications Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene SMC3
Gene Accession No. P97690, Q9CW03, Q9UQE7
Gene Alias Bam; Bamacan; basement membrane chondroitin sulfate proteoglycan; basement membrane-associated chondroitin proteoglycan; BMH; CDLS3; chondroitin sulfate proteoglycan 6; chondroitin sulfate proteoglycan 6 (bamacan); chromosome segregation protein SmcD; Chromosome-associated polypeptide; cspg6; HCAP; im:7142991; mad member-interacting protein 1; Mmip1; SMC protein 3; Smc3; SMC-3; SMC3 protein; SMC3L1; SmcD; structural maintenace of chromosomes 3; structural maintenance of chromosomes 3; structural maintenance of chromosomes protein 3; structural maintenance of chromosomes protein 3-like protein; wu:fb22e01; wu:fc30d07
Gene Symbols SMC3
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human SMC3 (1178-1216aa ELLESADKFYGVKFRNKVSHIDVITAEMAKDFVEDDTTH).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 13006, 29486, 9126
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.