missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SMC6L1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-33378
This item is not returnable.
View return policy
Description
SMC6L1 Polyclonal specifically detects SMC6L1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| SMC6L1 | |
| Polyclonal | |
| Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Q96SB8 | |
| SMC6 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: KEEHGKIKREELDVKHALSYNQRQLKELKDSKTDRLKRFGPNVPALLEAIDDAYRQGHFTYKPVGPLGACIHLRDPELALAIESCL | |
| 0.1 mL | |
| Cell Cycle and Replication, DNA Repair | |
| 79677 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| FLJ22116, hSMC6, SMC protein 6, SMC-6, SMC6 structural maintenance of chromosomes 6-like 1, SMC6 structural maintenance of chromosomes 6-like 1 (yeast), SMC6L1FLJ35534, structural maintenance of chromosomes 6, structural maintenance of chromosomes protein 6 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction