missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SMCX Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00 - € 539.00
Specifications
| Antigen | SMCX |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18247214
|
Novus Biologicals
NBP2-55541 |
100 μL |
€ 539.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18633638
|
Novus Biologicals
NBP2-55541-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SMCX Polyclonal specifically detects SMCX in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| SMCX | |
| Polyclonal | |
| Rabbit | |
| Human | |
| DXS1272EMRXJ, EC 1.14.11, EC 1.14.11.-, Histone demethylase JARID1C, JARID1Clysine-specific demethylase 5C, jumonji, AT rich interactive domain 1C, Jumonji, AT rich interactive domain 1C (RBP2-like), Jumonji/ARID domain-containing protein 1C, lysine (K)-specific demethylase 5C, MRXSJ, Protein SmcX, Protein Xe169, Smcx homolog, X chromosome, SMCXselected cDNA on X, Smcy homolog, X-linked, Smcy homolog, X-linked (mouse), XE169JmjC domain-containing protein SMCX | |
| KDM5C | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 8242 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EELEPKRVRSSGPEAEEVQEEEELEEETGGEGPPAPIPTTGSPSTQENQNGLEPAEGTTSGPSAPFSTLTPRLH | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title