missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SMG1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 292.00 - € 572.00
Specifications
| Antigen | SMG1 |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18472851
|
Novus Biologicals
NBP1-88913-25ul |
25 μL |
€ 292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18485181
|
Novus Biologicals
NBP1-88913 |
0.1 mL |
€ 572.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SMG1 Polyclonal antibody specifically detects SMG1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| SMG1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Protein Kinase | |
| PBS (pH 7.2) and 40% Glycerol | |
| 23049 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| ATXserine/threonine-protein kinase SMG1, EC 2.7.11, EC 2.7.11.1, hSMG-1,61E3.4, KIAA0421phosphatidylinositol 3-kinase-related protein kinase, Lambda/iota protein kinase C-interacting protein, Lambda-interacting protein, LIPPI-3-kinase-related kinase SMG-1, phosphatidylinositol 3-kinase-related kinase, SMG-1, SMG1 homolog, phosphatidylinositol 3-kinase-related kinase (C. elegans) | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: PGSRLSSGGTNYSRSWNDWQPRTDSASADPGNLKYSSSRDRGGSSSYGLQPSNSAVVSRQRHDDTRVHADIQNDEKGGYSVN | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title