missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SNAP45 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00
Specifications
| Antigen | SNAP45 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SNAP45 Polyclonal specifically detects SNAP45 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| SNAP45 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Proximal sequence element-binding transcription factor subunit delta, PSE-binding factor subunit delta, PTF subunit delta, PTFdelta, small nuclear RNA activating complex, polypeptide 2, 45kD, small nuclear RNA activating complex, polypeptide 2, 45kDa, Small nuclear RNA-activating complex polypeptide 2, SNAP45snRNA-activating protein complex 45 kDa subunit, SNAPc 45 kDa subunit, SNAPc subunit 2, snRNA-activating protein complex subunit 2 | |
| SNAPC2 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 6618 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ALVEHMTETYLRLTAPQPIPAGGSLGPAAEGDGAGSKAPEETPPATEKAEHSELKSPWQAAGICPLNPFLVPLELLGRA | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title