missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 30506154

SnoN Antibody [DyLight 755], Novus Biologicals Biologicals™

Product Code. 30506154 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30506154 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30506154 Supplier Novus Biologicals Supplier No. NBP338200IR

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

SnoN Polyclonal antibody specifically detects SnoN in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen SnoN
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate DyLight 755
Formulation 50mM Sodium Borate
Gene Alias SKI-like oncogene, Ski-related oncogene, ski-related oncogene snoN, Ski-related protein, SnoA, SnoI, SnoN, SNOski-like protein
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 350-450 of human SnoN (NP_005405.2).,, Sequence:, EMKEKFSMRSGKRNQSKTDAPSGMELQSWYPVIKQEGDHVSQTHSFLHPSYYLYMCDKVVAPNVSLTSAVSQSKELTKTEASKSISRQSEKAHSSGKLQKT
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Cancer, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 6498
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.