missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SNX11 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 292.00 - € 556.50
Specifications
| Antigen | SNX11 |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18418360
|
Novus Biologicals
NBP1-85825-25ul |
25 μL |
€ 292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18725543
|
Novus Biologicals
NBP1-85825 |
€ 589.00 € 556.50 / 0.10mL Save € 32.50 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||||
Description
SNX11 Polyclonal specifically detects SNX11 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| SNX11 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human, Mouse, Rat | |
| MGC111019, sorting nexin 11, sorting nexin-11 | |
| SNX11 | |
| IgG | |
| Affinity Purified | |
| Specificity of human SNX11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 29916 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:LFLQSQLSVPEIEACVQGRSTMTVSDAILRYAMSNCGWAQEERQSSSHLAKGDQPKSCCFLPRSGRRSSP | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title