missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SOCS-3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 302.00 - € 498.00
Specifications
| Antigen | SOCS-3 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18299723
|
Novus Biologicals
NBP2-57204 |
100 μL |
€ 498.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18656246
|
Novus Biologicals
NBP2-57204-25ul |
25 μL |
€ 302.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SOCS-3 Polyclonal specifically detects SOCS-3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| SOCS-3 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 9021 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| CIS3CIS-3, Cish3, cytokine-induced SH2 protein 3, Cytokine-inducible SH2 protein 3, SOCS-3STAT-induced STAT inhibitor 3, SSI-3ATOD4, SSI3MGC71791, suppressor of cytokine signaling 3 | |
| SOCS3 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title