missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ SOD2 (MnSOD) Polyclonal Antibody

Product Code. 15935615
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
15935615 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 15935615 Supplier Invitrogen™ Supplier No. PA580049

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Human HepG2 whole cell, rat liver tissue, rat lung tissue, mouse liver tissue, mouse lung tissue. IHC: human mammary cancer tissue. ICC/IF: A549 Cell, SMMC-7721 Cell.

Superoxide dismutase (SOD) is an antioxidant enzyme involved in the defense system against reactive oxygen species (ROS). SOD catalyzes the dismutation reaction of superoxide radical anion (O2) to hydrogen peroxide, which is then catalyzed to innocuous O2 and H2O by glutathione peroxidase and catalase. Several classes of SOD have been identified. These include intracellular copper, zinc SOD (Cu, Zn-SOD/SOD-1), mitochondrial manganese SOD (Mn-SOD/SOD-2) and extracellular Cu, Zn-SOD (EC-SOD/SOD-3). SOD1 is found in all eukaryotic species as a homodimeric 32 kDa enzyme containing one each of Cu and Zn ion per subunit. The manganese containing 80 kDa tetrameric enzyme SOD2, is located in the mitochondrial matrix in close proximity to a primary endogenous source of superoxide, the mitochondrial respiratory chain. SOD3 is a heparin-binding multimer of disulfide-linked dimers, primarily expressed in human lungs, vessel walls and airways. SOD4 is a copper chaperone for superoxide dismutase (CCS), which specifically delivers Cu to copper/zinc superoxide dismutase. CCS may activate copper/zinc superoxide dismutase through direct insertion of the Cu cofactor.
TRUSTED_SUSTAINABILITY

Specifications

Antigen SOD2 (MnSOD)
Applications Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene SOD2
Gene Accession No. P04179, P07895, P09671
Gene Alias I79_015272; indophenoloxidase B; IPO B; IPOB; IPO-B; manganese SOD; manganese superoxide dismutase; manganese-containing superoxide dismutase; mangano-superoxide dismutase; manganous superoxide dismutase; mitochondrial superoxide dismutase 2; Mn superoxide dismutase; MNSOD; Mn-SOD; MVCD6; similar to manganous superoxide dismutase; Sod2; Sod-2; sod2.L; sodMt; Superoxide dimutase 2, mitochondrial; superoxide dismutase; superoxide dismutase (Mn type); superoxide dismutase [Mn], mitochondrial; superoxide dismutase 2; superoxide dismutase 2 L homeolog; superoxide dismutase 2, mitochondrial; superoxide dismutase 2, mitochondrial L homeolog
Gene Symbols SOD2
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human SOD2 (192-222aa QYKNVRPDYLKAIWNVINWENVTERYMACKK).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 20656, 24787, 6648
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.