missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Sodium Potassium ATPase Alpha 1 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 204.00 - € 481.00
Specifications
| Antigen | Sodium Potassium ATPase Alpha 1 |
|---|---|
| Dilution | Western Blot 1:100 - 1:500, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18694952
|
Novus Biologicals
NBP2-95255-0.02ml |
0.02 mL |
€ 204.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18687922
|
Novus Biologicals
NBP2-95255-0.1ml |
0.1 mL |
€ 481.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Sodium Potassium ATPase Alpha 1 Polyclonal antibody specifically detects Sodium Potassium ATPase Alpha 1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| Sodium Potassium ATPase Alpha 1 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cancer, Cellular Markers, Growth and Development, Hypoxia, Neuronal Cell Markers, Neuroscience, Plasma Membrane Markers, Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 476 | |
| IgG | |
| Affinity purified |
| Western Blot 1:100 - 1:500, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| ATPase, Na+/K+ transporting, alpha 1 polypeptide, EC 3.6.3, EC 3.6.3.9, K-ATPase alpha-1 subunit, K-ATPase catalytic subunit alpha-A protein, MGC3285, MGC51750, Na, Na(+)/K(+) ATPase alpha-1 subunit, Na, K-ATPase, alpha-A catalytic polypeptide, Na+, K+ ATPase alpha subunit, Na+/K+ ATPase 1, sodium pump 1, Sodium pump subunit alpha-1, sodium/potassium-transporting ATPase subunit alpha-1, sodium-potassium-ATPase, alpha 1 polypeptide | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Sodium Potassium ATPase Alpha 1 (NP_000692.2). MGKGVGRDKYEPAAVSEQGDKKGKKGKKDRDMDELKKEVSMDDHKLSLDELHRKYGTDLSRGLTSARAAEILARDGPNALTPPPTTPEWIKFCRQLFGGF | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title