missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Somatostatin R4/SSTR4 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 196.00 - € 468.00
Specifications
| Antigen | Somatostatin R4/SSTR4 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
Somatostatin R4/SSTR4 Polyclonal antibody specifically detects Somatostatin R4/SSTR4 in Human, Mouse, Rat samples. It is validated for Western BlotSpecifications
| Somatostatin R4/SSTR4 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Breast Cancer, Cell Cycle and Replication, GPCR | |
| PBS (pH 7.3), 50% glycerol | |
| 6754 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| G-protein coupled receptor, somatostatin receptor 4, somatostatin receptor type 4, SS4R, SS-4-R, SS4-R | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 314-388 of human SSTR4 (NP_001043.2). LSDNFRRFFQRVLCLRCCLLEGAGGAEEEPLDYYATALKSKGGAGCMCPPLPCQQEALQPEPGRKRIPLTRTTTF | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title