missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Sorbitol Dehydrogenase Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-87415
This item is not returnable.
View return policy
Description
Sorbitol Dehydrogenase Polyclonal antibody specifically detects Sorbitol Dehydrogenase in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| Sorbitol Dehydrogenase | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| EC 1.1.1, EC 1.1.1.14, L-iditol 2-dehydrogenase, sorbitol dehydrogenase, SORD1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: PGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGG | |
| 0.1 mL | |
| Diabetes Research, Lipid and Metabolism | |
| 6652 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction