missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SP3, Mouse anti-Human, Clone: 3F2, Abnova™
Mouse Monoclonal Antibody
Brand: Abnova H00006670-M16.100ug
This item is not returnable.
View return policy
Description
Sequence: TAGINADGHLINTGQAMDSSDNSERTGERVSPDINETNTDTDLFVPTSSSSQLPVTIDSTGILQQNTNSLTTSSGQVHSSDLQGNYIQSPVSEETQAQNIQVSTAQPVVQHLQLQESQQPTSQAQIVQGITPQTIHGVQASGQN&asterisk;Specifications
| SP3 | |
| Monoclonal | |
| Unconjugated | |
| Sp3 transcription factor | |
| DKFZp686O1631/SPR-2 | |
| Mouse | |
| 100 μg | |
| Primary | |
| Human | |
| Antibody |
| ELISA, Western Blot | |
| 3F2 | |
| In 1x PBS, pH 7.4 | |
| NM_003111 | |
| SP3 | |
| SP3 (NP_003102, 287 a.a. ∼ 430 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | |
| RUO | |
| 6670 | |
| Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | |
| IgG2a κ |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction