missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SPDYC Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-80832
This item is not returnable.
View return policy
Description
SPDYC Polyclonal specifically detects SPDYC in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| SPDYC | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| hSpy/Ringo C, Rapid inducer of G2/M progression in oocytes C, RINGO C, Ringo2, speedy C, speedy homolog C (Xenopus laevis), speedy protein C | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 387778 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| SPDYC | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:SPLVTTQVELGGCSRQGGGNGFLRFRQHQEVQAFLSLLEDSFVQEFLSKDPCFQISDKY | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu