missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SPERT Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-86592
This item is not returnable.
View return policy
Description
SPERT Polyclonal specifically detects SPERT in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| SPERT | |
| Polyclonal | |
| Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:500-1:1000 | |
| CBY2spermatid flower-like structure protein, chibby homolog 2, FLJ35810, novel leucine zipper testicular protein, NURIT, Protein chibby homolog 2, spermatid associated, spermatid-associated protein, testis specific leucine zipper protein nurit, testis-specific leucine zipper protein nurit | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 220082 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| SPERT | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:ASQHSYPLNRFSSVPLDPMERPMSQADLELDYNPPRVQLSDEMFVFQDGRWVNENCRLQSPYFSPSASFHHKLHHK | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction