missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Spike RBD Antibody [mFluor Violet 610 SE], Novus Biologicals Biologicals™
Shop All Bio Techne ProductsDescription
Spike RBD Polyclonal antibody specifically detects Spike RBD in SARS-CoV samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | Spike RBD |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | mFluor Violet 610 SE |
| Formulation | 50mM Sodium Borate |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 350-450 of coronavirus Spike RBD (NP_828851.1).,, Sequence:, ADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRP |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Regulatory Status | RUO |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?