missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ SPIRE1 Recombinant Protein Antigen

Product Code. 18101040 Shop All Bio Techne Products
Click to view available options
Quantity:
0.1 mL
Conditionnement:
0.10mL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 18101040

Marque: Novus Biologicals™ NBP192438PEP

Please to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SPIRE1. The SPIRE1 Recombinant Protein Antigen is derived from E. coli. The SPIRE1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-92438. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

TRUSTED_SUSTAINABILITY

Spécification

Gene ID (Entrez) 56907
Species Human
Purification Method Chromatography
Purity >80%
Concentration 0.5mg/mL
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Formulation PBS and 1M Urea, pH 7.4.
For Use With (Application) Blocking/Neutralizing, Control
Gene Symbol SPIRE1
Label Type Unlabeled
Molecular Weight (g/mol) 27kDa
Product Type SPIRE1
Quantity 0.1 mL
Regulatory Status RUO
Source E.Coli
Specific Reactivity This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-92438. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Immunogen LEEIKAERKLRPVSPEEIRRSRLDVTTPESTKNLVESSMVNGGLTSQTKENGLSTSQQVPAQRKKLLRAPTLAELDSSESEEETLHK
Afficher plus Afficher moins

For Research Use Only

Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis