missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SPNS2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
Brand: Novus Biologicals NBP1-54345
This item is not returnable.
View return policy
Description
SPNS2 Polyclonal specifically detects SPNS2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| SPNS2 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| protein spinster homolog 2, spinster homolog 2 (Drosophila) | |
| Rabbit | |
| 60 kDa | |
| 100 μL | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 5 ug/ml | |
| Q8IVW8 | |
| SPNS2 | |
| Synthetic peptides corresponding to SPNS2(spinster homolog 2 (Drosophila)) The peptide sequence was selected from the N terminal of SPNS2 (NP_001118230). Peptide sequence PPGTPGTPGCAATAKGPGAQQPKPASLGRGRGAAAAILSLGNVLNYLDRY. | |
| Affinity purified | |
| RUO | |
| 124976 | |
| Human, Mouse, Rat, Pig, Rabbit | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction