missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SPPL2a Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 209.00 - € 482.00
Specifications
| Antigen | SPPL2a |
|---|---|
| Dilution | Western Blot 1:200-1:2000, Immunohistochemistry 1:50-1:200, Immunohistochemistry-Paraffin |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18610761
|
Novus Biologicals
NBP2-93234-0.02ml |
0.02 mL |
€ 209.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18617850
|
Novus Biologicals
NBP2-93234-0.1ml |
0.1 mL |
€ 482.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SPPL2a Polyclonal antibody specifically detects SPPL2a in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| SPPL2a | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cell Biology | |
| PBS (pH 7.3), 50% glycerol | |
| 84888 | |
| IgG | |
| Affinity purified |
| Western Blot 1:200-1:2000, Immunohistochemistry 1:50-1:200, Immunohistochemistry-Paraffin | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| EC 3.4.23, EC 3.4.23.-, IMP-3, IMP3intramembrane cleaving protease, Intramembrane protease 3, Presenilin-like protein 2, PSL2, signal peptide peptidase-like 2A, SPPL2a, SPP-like 2A | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 421-520 of human SPPL2A (NP_116191.2). AYCRRFDVQTGSSYIYYVSSTVAYAIGMILTFVVLVLMKKGQPALLYLVPCTLITASVVAWRRKEMKKFWKGNSYQMMDHLDCATNEENPVISGEQIVQQ | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title