missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SPT3 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 226.00 - € 468.00
Specifications
| Antigen | SPT3 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
SPT3 Polyclonal antibody specifically detects SPT3 in Human, Mouse samples. It is validated for Western BlotSpecifications
| SPT3 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cell Cycle and Replication | |
| PBS (pH 7.3), 50% glycerol | |
| 8464 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| SPT3-like protein, SPT3SPT3L, suppressor of Ty (S.cerevisiae) 3 homolog, suppressor of Ty 3 homolog (S. cerevisiae), transcription initiation protein SPT3 homolog | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 50-130 of human SPT3 (NP_852001.1). DARRPLHETAVLVEDVVHTQLINLLQQAAEVSQLRGARVITPEDLLFLMRKDKKKLRRLLKYMFIRDYKSKIVKGIDEDDL | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title