missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SSX5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP1-98335
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
SSX5 Polyclonal specifically detects SSX5 in Human samples. It is validated for Western Blot, Tissue Culture Substratum.
Especificaciones
| SSX5 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| MGC9494, protein SSX5, synovial sarcoma, X breakpoint 5 | |
| Rabbit | |
| 22 kDa | |
| 100 μL | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| NP_783729 | |
| SSX5 | |
| The immunogen for this antibody is SSX5 - C-terminal region. Peptide sequence EGNDSKGVPEASGPQNNGKQLRPSGKLNTSEKVNKTSGPKRGKHAWTHRV. | |
| Affinity purified | |
| RUO | |
| 6758 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction