missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ST6GALNAC3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00
Specifications
| Antigen | ST6GALNAC3 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ST6GALNAC3 Polyclonal specifically detects ST6GALNAC3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| ST6GALNAC3 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3, alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase III, EC 2.4.99.-, EC 2.4.99.7, FLJ13669, FLJ27239, GalNAc alpha-2,6-sialyltransferase III, PRO7177, sialyltransferase 7((alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminidealpha-2,6-sialyltransferase) C, Sialyltransferase 7C, SIAT7C, SIAT7-C, ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltran, ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltransferase 3, ST6GalNAc III, ST6GALNACIII, STY | |
| ST6GALNAC3 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 256435 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EANTTIYVIWGPFRNMRKDGNGIVYNMLKKTVGIYPNAQIYVTTEKRMSYCDGVFKKETGKDRVQSGS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title