missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ST6GALNAC4 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93510-0.1ml
This item is not returnable.
View return policy
Description
ST6GALNAC4 Polyclonal antibody specifically detects ST6GALNAC4 in Human, Mouse samples. It is validated for Western Blot
Specifications
| ST6GALNAC4 | |
| Polyclonal | |
| Western Blot 1:1000-1:2000 | |
| EC 2.4.99, EC 2.4.99.7, NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc-alpha-2,6-sialyltransferase, NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc-alpha-2,6-sialyltransferase IV, Sialyltransferase 3C, Sialyltransferase 7D, sialyltransferase 7D((alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminidealpha-2,6-sialyltransferase), SIAT3-C, SIAT3C6-sialyltransferasealpha2,6-sialyltransferase, SIAT7-D, ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltransferase 4, ST6GalNAc IV, ST6GalNAcIV | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 120-210 of human ST6GALNAC4 (NP_778204.1). TLRVVSHTSVPLLLRNYSHYFQKARDTLYMVWGQGRHMDRVLGGRTYRTLLQLTRMYPGLQVYTFTERMMAYCDQIFQDETGKNRRQSGSF | |
| 0.1 mL | |
| Primary | |
| Human, Mouse | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 27090 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?